Extended-Spectrum Cephalosporinase in. Acinetobacter baumannii
|
|
- Antonia Lloyd
- 6 years ago
- Views:
Transcription
1 AAC Accepts, published online ahead of print on 1 June 0 Antimicrob. Agents Chemother. doi:./aac Copyright 0, American Society for Microbiology and/or the Listed Authors/Institutions. All Rights Reserved. 1 REVISED AAC Extended-Spectrum Cephalosporinase in Acinetobacter baumannii José-Manuel Rodríguez-Martínez, 1 Patrice Nordmann, 1 * Esthel Ronco, and Laurent Poirel 1 Service de Bactériologie-Virologie, INSERM U1 Emerging Resistance to Antibiotics, Assist. Publique/Hôp. de Paris, Faculté de Médecine and Université Paris-Sud, Hôpital de Bicêtre, K.-Bicêtre, 1 and Service de Microbiologie, Hôpital Raymond Poincaré, Assist. Publique/Hôp. de Paris, Faculté de Médecine Paris-Ouest, 0 Garches, France Keywords: Extended-Spectrum AmpC, A. baumannii, cefepime Running title: ESAC in A. baumannii * Corresponding author. Mailing address: Service de Bactériologie-Virologie, Hôpital de Bicêtre, rue du Général Leclerc, Le Kremlin-Bicêtre Cedex, France. Phone: Fax: nordmann.patrice@bct.aphp.fr Downloaded from on May, 01 by guest 1
2 An AmpC-type β-lactamase conferring high level resistance to expanded- spectrum cephalosporins and monobactams was characterized from an Acinetobacter baumannii clinical isolate. This class C ß-lactamase (named ADC-) possessed a ProArg substitution together with a duplication of an Ala residue at position 1 (inside the Ω-loop) compared to a reference AmpC cephalosporinase from A. baumannii. ADC- hydrolyzed ceftazidime, cefepime and aztreonam at high level, that allows to classify this enzyme as an Extended- Spectrum AmpC (ESAC). Site-directed mutagenesis confirmed the role of both substitutions in its ESAC property. Downloaded from on May, 01 by guest
3 Acinetobacter baumannii is commonly associated with serious nosocomial infections (,, ). The emergence of multidrug-resistant A. baumannii strains, and specifically those resistant to carbapenems, has created severe therapeutic challenges. A growing number of β-lactamases conferring resistance to expanded-spectrum cephalosporins have been identified in Acinetobacter spp. Resistance to oxyiminocephalosporins (ceftazidime and cefotaxime) is usually related to the overproduction of the resident AmpC-type β-lactamase (1,, ) encoded by the gene bla ampc. The overexpression of that latter gene has been associated to the insertion sequence ISAba1 providing a strong promoter (, ). Recently, the AmpC variants have been named according to a nomenclature specific to A. baumannii, being ADC for Acinetobacter- Derived Cephalosporinases (). Most AmpC-type β-lactamases naturally produced by Gram-negatives hydrolyze amino- and ureido-penicillins, cephamycins (cefoxitin and cefotetan) and at a lower Downloaded from on May, 01 by guest 1 level oxyimino-cephalosporins, such as ceftazidime, cefotaxime and ceftriaxone, and 1 monobactams such as aztreonam (). Zwitteronic cephalosporins (cefepime and 1 cefpirome) together with carbapenems are usually excluded from the spectrum of 1 activity of AmpC β-lactamases (). However, natural cephalosporinases possessing
4 broadened substrate activity have been reported in Enterobacteriaceae and Pseudomonas aeruginosa (1, 1, ). These Extended-Spectrum AmpCs (ESAC) confer reduced susceptibility to all cephalosporins (1, 1, ). They differ from regular cephalosporinases by amino acid substitutions or insertions/deletions in four specific regions that are all located in the vicinity of the active site: the Ω loop, the H- helix, the H- helix and the C-terminal extremity of the protein (1, 1, ). Here, we describe the first ESAC-type β-lactamase from A. baumannii with a broadened substrate activity toward expanded-spectrum cephalosporins and monobactams. A. baumannii KI clinical isolate was obtained from a rectal screening of a patient who had been transferred from the Guadeloupe Islands (French Caribbean Islands) and admitted at the Raymond Poincaré hospital (Garches, Paris, France) in January 00. This patient did not receive any antibiotic treatment. A. baumannii KI was selected for further study on the basis of its uncommon pattern of resistance to β-lactam antibiotics, Downloaded from on May, 01 by guest 1 including high level resistance to expanded-spectrum cephalosporins and reduced 1 susceptibility to carbapenems. In addition, it was resistant to cotrimoxazole and 1 fluoroquinolones, and susceptible to aminoglycosides.
5 Susceptibility testing were performed by Etest (1) and interpreted according to the CLSI guidelines (). It showed that A. baumannii KI was resistant to amino-, carboxy- and ureido-penicillins, to expanded-spectrum cephalosporins including ceftazidime, cefotaxime, ceftriaxone, cefepime, and cefpirome, to aztreonam, and had reduced susceptibility to imipenem and meropenem (Table ). Using cloxacillincontaining plates as described (), the susceptibility to ceftazidime and cefepime were restored, suggesting i) overproduction of the AmpC β-lactamase, and ii) the likelihood for this AmpC to possess ESAC properties. Mating-out assays and electrotransformation were performed as described (0), but failed to transfer any cephalosporin resistance marker from A. baumannii KI to A. baumannii BM or to E. coli TOP recipient strains, suggesting that this resistance to expanded-spectrum cephalosporins was chromosomally-encoded. Whole-cell DNA of A. baumannii KI was extracted as described previously (). Primers PreAmpC-PISAba1 and PreAmpC-Ab1 were used in combination with primer PreAmpC-Ab to amplify 1,1-bp and 1,-bp Downloaded from on May, 01 by guest 1 fragments, respectively, encompassing the entire bla ampc gene with or without the 1 P ISAba1 promoter, respectively (Table 1). All the inserts containing the P ISAba1 promoter 1 will be named accordingly with P+. The amplification products were cloned into E.
6 coli Top using the ZeroBlunt TOPO PCR cloning kit (Invitrogen, Cergy-Pontoise, France) followed by selection on plates containing 0 µg/ml of amoxicillin and 0 µg/ml of kanamycin. A. baumannii strains AYE and CIP0 reference strains were used to clone two regular bla ampc β-lactamase genes (, 1). Strains AYE corresponds to a multidrug resistant isolate from France (1) whose complete genome sequence was determined (, ). DNA sequence analysis showed that β-lactamase ADC- had and amino acid changes compared to regular β-lactamases ADC-0 and ADC-, corresponding to the ADC ß-lactamases of strains CIP0 and AYE, respectively (Fig. 1). No amino acid change was identified among the conserved motifs SVSK, YSN or KTG, neither in the helix H- or helix H-, previously associated to the extended activity of ESACs (1, 1, ). However, a single amino acid substitution, ProArg, associated with a duplication of the Ala residue at position 1, both of them located inside the Ω-loop, were identified. Thus, the molecular basis of the extended-spectrum hydrolysis profile of ADC- might be related to those specific substitutions. The Downloaded from on May, 01 by guest 1 presence of the insertion sequence ISAba1 providing strong promoter sequences (- 1 [TTAGAA] and - [TTATTT]) immediately upstream of the bla ampc gene was noticed, 1 as previously observed when the bla ampc gene is overexpressed ().
7 MICs of all β-lactams for the different clones were higher in the presence of the P ISAba1 promoter (Table ). E. coli TOP (padc--p+) was resistant to most β- lactams except to cefepime, cefpirome, and carbapenems. E. coli TOP (padc-- P+), producing a regular cephalosporinase, was resistant to amoxicillin and to narrow spectrum cephalosporins and remained susceptible to the expanded-spectrum cephalosporins, including ceftazidime, cefotaxime, cefepime, cefpirome and aztreonam (Table ). The recombinant E. coli strain harboring the bla ADC- gene showed a broadened hydrolytic activity against ceftazidime, cefotaxime, cefepime, cefpirome and aztreonam compared to the regular variant, increasing the resistance rates significantly (from to 1-fold), suggesting that ADC- might be considered as an ESAC enzyme. In order to better define the clinical impact of this ADC- variant, recombinant plasmids padc--p+ and padc--p+ were additionnally electro-transformed into E. coli HB (lacking OmpC and OmpF porins) (1). By using E. coli HB, our aim was to mirror the intrinsic weak permeability of A. baumannii and therefore better appreciating Downloaded from on May, 01 by guest 1 the impact of the ESAC enzymes. MICs of cefepime, cefpirome and aztreonam for the 1 ESAC and regular variants were, 1, > µg/ml and,, 1 µg/ml, respectively 1 (data not shown). Those MIC values were higher than those observed of the wild-type
8 E. coli strain, as expected. The significantly different impact on the resistance level shown by the ESAC and non-esac AmpC variants in a porin-deficient E. coli strain would also likely apply to A. baumannii. Isoelectric focusing analysis performed as described (1) using crude culture extracts of A. baumannii KI and of the different clones obtained by sonication gave a single β-lactamase signal for all of them, corresponding to a pi value of. consistent with the production of an AmpC β-lactamase. β-lactamases ADC- and ADC- were purified to near homogeneity (>%) as previously described (0). The molecular mass of those proteins determined by SDS- PAGE analysis was kda. The specific activities, determined with 0 µm of benzylpenicillin as substrate, were and µmol/min/mg of protein for ADC- and ADC-, respectively. Purified β-lactamases ADC- and ADC- were used for kinetic measurements (K m and k cat ) calculated as described (0). The kinetic parameters for penicillins and Downloaded from on May, 01 by guest 1 carbapenems for both AmpC enzymes were similar whereas the catalytic efficiency of 1 the purified β-lactamase ADC- against cephalosporins was higher than that of ADC- 1 (Table ). This higher catalytic efficiency observed for ADC- was noticeable in
9 particular for ceftazidime, cefotaxime, cefepime, cefpirome, and aztreonam (Table ). Those data confirmed the ESAC property of ADC-, that associates two specific features being i) an higher ability to hydrolyze ceftazidime, cefotaxime and aztreonam compared to a regular AmpC, and ii) an extended spectrum activity toward cefepime and cefpirome which are substrates usually weakly hydrolyzed by regular AmpCs. No significant difference of IC 0 values for clavulanic acid was observed between both enzymes (1. and.1 mm, for ADC- and ADC-, respectively). Compared to the regular ADC- β-lactamase, ADC- contained several amino acid substitutions, including the substitution ProArg together with a duplication of the Ala residue at position 1 located inside the Ω-loop. A site-directed mutagenesis strategy was used with a protocole described by the manufacturer (Quick change sitedirected mutagenesis kit; Stratagene) and as reported (1) for evaluating the amino acid changes that could be involved in the extended-spectrum resistance spectrum of ADC-. Using recombinant plasmids padc--p+ and padc--p+ as templates, and Downloaded from on May, 01 by guest 1 primers KI-A1-DelF/KI-A1-DelR and Aye-A1-InsF/Aye-A1-InsR, deletion or 1 insertion of Ala1 residue were respectively performed (Table 1). This allowed to 1 obtain recombinant plasmids padc--p+(a1del) (with a single A1 residue) and
10 padc--p+(a1ins) (with two A1 residues). Then the ArgPro and ProArg substitutions were generated by using primers KI-RP-F/KI-RP-R and Aye- PR-F/Aye-PR-R, respectively (Table 1) obtaining other recombinant strains in a second step as indicated in Table. Sequence analysis of the different inserts confirmed the presence of the expected amino acid changes. Duplication of the Ala1 residue in β-lactamase ADC- resulted in an increased resistance pattern toward expanded-spectrum cephalosporins (Table ), that was however not sufficient to explain MIC differences observed between E. coli (padc--p+) and E. coli (padc--p+). Thus, as a second step, the ProArg substitution was generated allowing to achieve an identical ESAC phenotype as compared to ADC-. Similarly, the reverse modifications performed with ADC- allowed the recovery of the regular AmpC phenotype, supporting the hypothesis that both amino acid modifications (Ala1 duplication and ProArg substitution) were responsible for the extended-spectrum profile of ADC- (Table ). Whether the other Downloaded from on May, 01 by guest 1 amino acid differences identified between ADC- and ADC- (Fig. 1) could play a 1 specific role in the functionality or stability of ß-lactamase ADC- remains unclear.
11 Extension of the Ω-loop for AmpC β-lactamase from Enterobacter cloacae has been shown to broaden its hydrolysis spectrum (1, 1). In that latter case, the mutant enzyme exhibited an increased opening of the entrance of the substrate-binding pocket (). The Ala1 duplication that is observed here in AmpC ADC- might have similar consequences for its hydrolysis spectrum. We describe here the first ESAC conferring resistance to expanded-spectrum cephalosporins in A. baumannii after those reported in Enterobacteriaceae and recently in P. aeruginosa. Noticeably, ADC- expression did not have any impact on carbapenem resistance. Clinical implications and spread of this resistance trait shall be now evaluated with A. baumannii isolates from worldwide origin. Funding This work was partially funded by a grant from the INSERM, the Ministère de l'education Nationale et de la Recherche (UPRES-EA), Université Paris XI, France Downloaded from on May, 01 by guest 1 and mostly by a grant from the European Community (TROCAR, HEALTH-F ). J-M. R-M. is funded by a postdoctoral grant from the Ministerio de Educacion 1 y Ciencia (00/0). Partially Supported by Ministerio de Sanidad y Consumo,
12 Instituto de Salud Carlos III - FEDER, Spanish Network for the Research in Infectious Diseases (REIPI RD0/000). Acknowledgments We thank R. Bonomo for managing the ADC nomenclature and providing us with ADC names. Downloaded from on May, 01 by guest 1
13 REFERENCES 1.Bou, G. and J. Martinez-Beltran Cloning, nucleotide sequencing, and analysis of the gene encoding an AmpC β-lactamase in Acinetobacter baumannii. Antimicrob. Agents Chemother. :-..Bratu, S., D. Landman, D. A. Martin, C. Georgescu, and J. Quale. 00. Correlation of antimicrobial resistance with β-lactamases, the OmpA-like porin, and efflux pumps in clinical isolates of Acinetobacter baumannii endemic to New York City. Antimicrob. Agents Chemother. :-00..Bush, K., G. A. Jacoby, and A. A. Medeiros. 1. A functional classification scheme for β-lactamases and its correlation with molecular structure. Antimicrob. Agents Chemother. :1-1..Cisneros, J. M. and J. Rodriguez-Baño. 00. Nosocomial bacteremia due to Downloaded from on May, 01 by guest 1 Acinetobacter baumannii: epidemiology, clinical features and treatment. Clin. 1 Microbiol. Infect. :-. 1
14 . Clinical and Laboratory Standards Institute. 0. Performance standards for antimicrobial susceptibility testing. CLSI M0-S0. Clinical and Laboratory Standards Institute, Wayne, PA..Crichlow, G. V., A. P. Kuzin, M. Nukaga, K. Mayama, T. Sawai, and J. R. 1 1 Knox. 1. Structure of the extended-spectrum class C β-lactamase of Enterobacter cloacae GC1, a natural mutant with a tandem tripeptide insertion. Biochemistry :-1..Fournier, P. E., D. Vallenet, V. Barbe, S. Audic, H. Ogata, L. Poirel, H. Richet, C. Robert, S. Mangenot, C. Abergel, P. Nordmann, J. Weissenbach, D. Raoult, and J. M. Claverie. 00. Comparative genomics of multidrug resistance in Acinetobacter baumannii. PLoS. Genet. :e..hancock, R. E. and F. Bellido. 1. Antibacterial in vitro activity of fourth generation cephalosporins. J. Chemother. Suppl :1-. Downloaded from on May, 01 by guest 1.Héritier, C., L. Poirel, and P. Nordmann. 00. Cephalosporinase over- 1 expression resulting from insertion of ISAba1 in Acinetobacter baumannii. Clin. 1 Microbiol. Infect. 1:1-. 1
15 . Hujer, K. M., N. S. Hamza, A. M. Hujer, F. Perez, M. S. Helfand, C. R. Bethel, J. M. Thomson, V. E. Anderson, M. Barlow, L. B. Rice, F. C. Tenover, and R. A. Bonomo. 00. Identification of a new allelic variant of the Acinetobacter baumannii cephalosporinase, ADC- β-lactamase: defining a 1 1 unique family of class C enzymes. Antimicrob. Agents Chemother. :1-.. Levin, A. S., C. E. Levy, A. E. Manrique, E. A. Medeiros, and S. F. Costa. 00. Severe nosocomial infections with imipenem-resistant Acinetobacter baumannii treated with ampicillin/sulbactam. Int. J. Antimicrob. Agents 1:-. 1. Mammeri, H. and P. Nordmann. 00. Extended-spectrum cephalosporinases in Enterobacteriaceae. Anti-Infect. Agents Med. Chem. : Mammeri, H., P. Nordmann, A. Berkani, and F. Eb. 00. Contribution of Downloaded from on May, 01 by guest 1 extended-spectrum AmpC (ESAC) β-lactamases to carbapenem resistance in 1 Escherichia coli. FEMS Microbiol. Lett. :-0. 1
16 1. Nordmann, P. and H. Mammeri. 00. Extended-spectrum cephalosporinases: structure, detection and epidemiology. Future Microbiol. : Nukaga, M., S. Haruta, K. Tanimoto, K. Kogure, K. Taniguchi, M. Tamaki, and T. Sawai. 1. Molecular evolution of a class C β-lactamase extending its 1 substrate specificity. J. Biol. Chem. 0:-. 1. Nukaga, M., K. Taniguchi, Y. Washio, and T. Sawai. 1. Effect of an amino acid insertion into the omega loop region of a class C β-lactamase on its substrate specificity. Biochemistry : Philippon, L. N., T. Naas, A. T. Bouthors, V. Barakett, and P. Nordmann. 1. OXA-1, a class D clavulanic acid-inhibited extended-spectrum β- lactamase from Pseudomonas aeruginosa. Antimicrob. Agents Chemother. 1:1-1. Downloaded from on May, 01 by guest 1 1. Poirel, L., S. Marqué, C. Héritier, C. Segonds, G. Chabanon, and P. 1 Nordmann. 00. OXA-, a novel class D β-lactamase involved in resistance 1 to carbapenems in Acinetobacter baumannii. Antimicrob. Agents Chemother. 1 :0-0. 1
17 1. Poirel L, Naas T, Guibert M, Chaibi EB, Labia R, Nordmann P. 1. Molecular and biochemical characterization of VEB-1, a novel class A extended-spectrum ß-lactamase encoded by an Escherichia coli integron gene. Antimicrob. Agents Chemother. : Potron, A., L. Poirel, J. Croizé, V. Chanteperdrix, and P. Nordmann. 00. Genetic and biochemical characterization of the first extended-spectrum CARBtype β-lactamase, RTG-, from Acinetobacter baumannii. Antimicrob. Agents Chemother. : Rodriguez-Martinez, J. M., P. Nordmann, N. Fortineau, and L. Poirel. 0. VIM-1, a metallo-β-lactamase with increased carbapenemase activity from Escherichia coli and Klebsiella pneumoniae. Antimicrob. Agents Chemother. :1-.. Rodriguez-Martinez, J. M., L. Poirel, and P. Nordmann. 00. Extended- Downloaded from on May, 01 by guest 1 spectrum cephalosporinases in Pseudomonas aeruginosa. Antimicrob. Agents 1 Chemother. :1-. 1
18 . Smolyakov, R., A. Borer, K. Riesenberg, F. Schlaeffer, M. Alkan, A. Porath, D. Rimar, Y. Almog, and J. Gilad. 00. Nosocomial multi-drug resistant Acinetobacter baumannii bloodstream infection: risk factors and outcome with ampicillin-sulbactam treatment. J. Hosp. Infect. :-.. Vallenet, D., P. Nordmann, V. Barbe, L. Poirel, S. Mangenot, E. Bataille, C. Dossat, S. Gas, A. Kreimeyer, P. Lenoble, S. Oztas, J. Poulain, B. Segurens, C. Robert, C. Abergel, J.-M. Claverie, D. Raoult, C. Médigue, J. Weissenbach, and S. Cruveiller. 00. Comparative analysis of Acinetobacters: three genomes for three lifestyles. PLoS One ():e. Downloaded from on May, 01 by guest 1
19 Table 1. Primers used in this work. Primer Sequence ( to ) PCR product size (bp) Purpose PreAmpC-Ab1 GAGCTAATCATGCGATTTAAA 1, Cloning AmpC CDS region PreAmpC-Ab GCTTAGGATATGTTTGGTTCTT PreAmpC-PISAba1 GACCTGCAAAGAAGCGCTGC 1,1 (with PreAmC-Ab) Cloning AmpC plus P ISAba1 AmpC-Ab1 GGAAAGGTTGTGGCTTTGTCT AmpC Sequencing Site directed mutagenesis KI-A1-DelF GGC CCA CTC GAT GCC CCA GCA TAT GGC Deletion of Ala1 KI-A1-DelR GCC ATA TGC TGG GGC ATC GAG TGG GCC Aye-A1-InsF GGC CCA CTC GAT GCC GCC CCA GCA TAT GGC* Insertion of Ala1 Aye-A1-InsR GCC ATA TGC TGG GGC GGC ATC GAG TGG GCC Aye-PR-F ATT CGA GTT AAC CGC GGC CCA CTC GAT GCC Substitution ProArg Aye-PR-R GGC ATC GAG TGG GCC GCG GTT AAC TCG AAT KI-RP-F ATT CGA GTT AAC CCC GGC CCA CTC GAT GCC Substitution ArgPro KI-RP-R GGC ATC GAG TGG GCC GGG GTT AAC TCG AAT *Modified bp are underlined. 1 Downloaded from on May, 01 by guest
20 Table. MICs of β-lactams for A. baumannii KI, A. baumannii AYE expressing the ESBL VEB-1, reference strain A. baumannii CIP0, E. coli TOP strains harbouring recombinant plasmid padc-, padc-, padc-0, padc--p+, padc--p+, padc--p+ (A1Del), padc--p+ (A1Ins), padc--p+ (A1Del+RP), padc--p+ (A1Ins+PR), and E. coli TOP reference strain. β-lactam (s) a A. baumannii KI A. baumannii CIP0. A. baumannii AYE E. coli TOP (padc-) E. coli TOP (padc-0) E. coli TOP (padc-) E. coli TOP (padc--p+) b E. coli TOP (padc--p+) E. coli TOP (padc--p+) E. coli TOP (padc--p+) E. coli TOP (padc--p+) E. coli TOP (padc--p+) E. coli TOP (ptopo) A1Del c A1Ins d A1Del+RP A1Ins+PR Amoxicillin > > > > > > > > > > Amoxicillin+ CLA 1 1 > > > > > Ticarcillin > > > 1 > 1 > Ticarcillin + CLA 1 > 1 > 1 > Piperacillin > 1 > 1 > > > > > > 1 Piperacillin + TZB > Cefuroxime > > > 1 > > > > > > Ceftazidime > > > > 1 > > 0.1 Cefotaxime > > > 1 > 0.0 Cefepime 1 > Downloaded from on May, 01 by guest
21 Cefpirome > > Aztreonam > Imipenem Meropenem a CLA, clavulanic acid at a fixed concentration of µg/ml; TZB, tazobactam at a fixed concentration of µg/ml. b P+ correspond to entire blaampc gene including PISAba1 promoter. c A1Del correspond to the deletion of this Alanine residue at position 1. d A1Ins correspond to the insertion of this Alanine residue at position 1. 1 Downloaded from on May, 01 by guest
22 1 1 Table. Kinetic parameters of ß-lactamases ADC- (ESAC) and ADC- of A. baumannii ADC- ADC- β-lactam Km kcat kcat/km Km kcat kcat/km kcat/km (µm - 1.s -1 ) (µm) (s -1 ) (µm -1 s -1 ) (µm) (s -1 ) (µm -1 s -1 ) for ADC-/ADC- Benzylpenicillin Ampicillin Piperacillin Cephaloridine Cephalothin Cefoxitin b Cefotaxime b Downloaded from Ceftazidime Cefepime 1, , Cefpirome , Aztreonam b ND a ND -- Imipenem a ND, no detectable hydrolysis (< 0.01 s -1 ), for a maximum amount of µg of purified enzyme, and up to 00 nmol of substrate. on May, 01 by guest
23 b For β-lactams with a Km value less than µm, Ki values were determined instead of Km values, with cephalothin used as the substrate. Data are the means of three independent experiments. Standard deviations were within 1% of the means. Downloaded from on May, 01 by guest
24 Legend to Figure. Amino acid sequence alignment including ADC- as an ESAC, ADC-0 and ADC- as regular AmpCs, and ADC- taken as reference sequence as published (). Amino acid identities are indicated by dashes. The typical AmpC β-lactamase domains (SVSK, YSN, and KTG) are underlined. The helix H- and H- are boxed in grey. The Ω-loop is boxed in grey and double underlined. Differences observed inside the Ω- loop are boldened. The vertical arrow indicates the position of the +1 amino acid (cleavage site for signal peptide). Numbering is according to the sequence of the mature protein. Downloaded from on May, 01 by guest
25 ADC- ADC-0 ADC- ADC MRFKKISCLLLSPLFIFSTSIYAGNTPKDQEIKKLVDQNFKPLLEKYDVPGMAVGVIQNNKKYEMYYGLQSVQDKKAVNSSTIFELGSVSKLFTATAGGYAKNKGKISFDDTPGKYWKELKNTPIDQV F R D N ADC- NLLQLATYTSGNLALQFPDEVKTDQQVLTFFKDWKPKNSIGEYRQYSNPSIGLFGKVVALSMNKPFDQVLEKTIFPALGLKHSYVNVPKTQMQNYAFGYNQENQPIRVNRGPLDAAPAYGVKSTLPDM ADC Q P A P ADC Q Q---P P ADC Q P P ADC- ADC-0 ADC- ADC LSFIHANLNPQKYPADIQRAINETHQGRYQVNTMYQALGWEEFSYPATLQTLLDSNSEQIVMKPNKVTAISKEPSVKMYHKTGSTNGFGTYVVFIPKENIGLVMLTNKRIPNEERIKAAYAVLNAIKK F TP F D T S V Downloaded from on May, 01 by guest
ESBL- and carbapenemase-producing microorganisms; state of the art. Laurent POIREL
ESBL- and carbapenemase-producing microorganisms; state of the art Laurent POIREL Medical and Molecular Microbiology Unit Dept of Medicine University of Fribourg Switzerland INSERM U914 «Emerging Resistance
More informationESBL Producers An Increasing Problem: An Overview Of An Underrated Threat
ESBL Producers An Increasing Problem: An Overview Of An Underrated Threat Hicham Ezzat Professor of Microbiology and Immunology Cairo University Introduction 1 Since the 1980s there have been dramatic
More informationMechanism of antibiotic resistance
Mechanism of antibiotic resistance Dr.Siriwoot Sookkhee Ph.D (Biopharmaceutics) Department of Microbiology Faculty of Medicine, Chiang Mai University Antibiotic resistance Cross-resistance : resistance
More informationComparative Assessment of b-lactamases Produced by Multidrug Resistant Bacteria
Comparative Assessment of b-lactamases Produced by Multidrug Resistant Bacteria Juhee Ahn Department of Medical Biomaterials Engineering Kangwon National University October 23, 27 Antibiotic Development
More informationPrevalence of Metallo-Beta-Lactamase Producing Pseudomonas aeruginosa and its antibiogram in a tertiary care centre
International Journal of Current Microbiology and Applied Sciences ISSN: 2319-7706 Volume 4 Number 9 (2015) pp. 952-956 http://www.ijcmas.com Original Research Article Prevalence of Metallo-Beta-Lactamase
More informationAddressing the evolving challenge of β-lactamase mediated antimicrobial resistance: ETX2514, a next-generation BLI with potent broadspectrum
Addressing the evolving challenge of β-lactamase mediated antimicrobial resistance: ETX2514, a next-generation BLI with potent broadspectrum activity against Class A, C and D enzymes Alita Miller, PhD
More informationESCMID Online Lecture Library. by author
Expert rules in susceptibility testing EUCAST-ESGARS-EPASG Educational Workshop Linz, 16 19 September, 2014 Dr. Rafael Cantón Hospital Universitario Ramón y Cajal SERVICIO DE MICROBIOLOGÍA Y PARASITOLOGÍA
More informationETX2514: Responding to the global threat of nosocomial multidrug and extremely drug resistant Gram-negative pathogens
ETX2514: Responding to the global threat of nosocomial multidrug and extremely drug resistant Gram-negative pathogens Ruben Tommasi, PhD Chief Scientific Officer ECCMID 2017 April 24, 2017 Vienna, Austria
More informationPrevalence of Extended-spectrum β-lactamase Producing Enterobacteriaceae Strains in Latvia
Prevalence of Extended-spectrum β-lactamase Producing Enterobacteriaceae Strains in Latvia Ruta Paberza 1, Solvita Selderiņa 1, Sandra Leja 1, Jelena Storoženko 1, Lilija Lužbinska 1, Aija Žileviča 2*
More informationCONTAGIOUS COMMENTS Department of Epidemiology
VOLUME XXIII NUMBER 1 July 2008 CONTAGIOUS COMMENTS Department of Epidemiology Bugs and Drugs Elaine Dowell, SM (ASCP), Marti Roe SM (ASCP), Ann-Christine Nyquist MD, MSPH Are the bugs winning? The 2007
More informationChemotherapy of bacterial infections. Part II. Mechanisms of Resistance. evolution of antimicrobial resistance
Chemotherapy of bacterial infections. Part II. Mechanisms of Resistance evolution of antimicrobial resistance Mechanism of bacterial genetic variability Point mutations may occur in a nucleotide base pair,
More information2015 Antimicrobial Susceptibility Report
Gram negative Sepsis Outcome Programme (GNSOP) 2015 Antimicrobial Susceptibility Report Prepared by A/Professor Thomas Gottlieb Concord Hospital Sydney Jan Bell The University of Adelaide Adelaide On behalf
More informationRESEARCH NOTE. Molecular epidemiology of carbapenemresistant Acinetobacter baumannii in New Caledonia
Research tes 977 routine clinical testing. J Antimicrob Chemother 2002; 40: 2755 2759. 20. Galani I, Rekatsina PD, Hatzaki D et al. Evaluation of different laboratory tests for the detection of metallob-lactamase
More informationMICRONAUT MICRONAUT-S Detection of Resistance Mechanisms. Innovation with Integrity BMD MIC
MICRONAUT Detection of Resistance Mechanisms Innovation with Integrity BMD MIC Automated and Customized Susceptibility Testing For detection of resistance mechanisms and specific resistances of clinical
More informationOther β-lactamase Inhibitor (BLI) Combinations: Focus on VNRX-5133, WCK 5222 and ETX2514SUL
Other β-lactamase Inhibitor (BLI) Combinations: Focus on VNRX-5133, WCK 5222 and ETX2514SUL David P. Nicolau, PharmD, FCCP, FIDSA Director, Center for Anti-Infective Research and Development Hartford Hospital
More informationWitchcraft for Gram negatives
Witchcraft for Gram negatives Dr Subramanian S MD DNB MNAMS AB (Medicine, Infect Dis) Infectious Diseases Consultant Global Health City, Chennai www.asksubra.com Drug resistance follows the drug like a
More informationWhat does multiresistance actually mean? Yohei Doi, MD, PhD University of Pittsburgh
What does multiresistance actually mean? Yohei Doi, MD, PhD University of Pittsburgh Disclosures Merck Research grant Clinical context of multiresistance Resistance to more classes of agents Less options
More informationActivity of a novel aminoglycoside, ACHN-490, against clinical isolates of Escherichia coli and Klebsiella pneumoniae from New York City
Journal of Antimicrobial Chemotherapy Advance Access published July 31, 2010 J Antimicrob Chemother doi:10.1093/jac/dkq278 Activity of a novel aminoglycoside, ACHN-490, against clinical isolates of Escherichia
More informationIntrinsic, implied and default resistance
Appendix A Intrinsic, implied and default resistance Magiorakos et al. [1] and CLSI [2] are our primary sources of information on intrinsic resistance. Sanford et al. [3] and Gilbert et al. [4] have been
More informationHelen Heffernan and Rosemary Woodhouse Antibiotic Reference Laboratory
METHODS USED IN NEW ZEALAND DIAGNOSTIC LABORATORIES TO IDENTIFY AND REPORT EXTENDED-SPECTRUM β-lactamase- PRODUCING ENTEROBACTERIACEAE by Helen Heffernan and Rosemary Woodhouse Antibiotic Reference Laboratory
More informationAntimicrobial Cycling. Donald E Low University of Toronto
Antimicrobial Cycling Donald E Low University of Toronto Bad Bugs, No Drugs 1 The Antimicrobial Availability Task Force of the IDSA 1 identified as particularly problematic pathogens A. baumannii and
More informationDetection of Inducible AmpC β-lactamase-producing Gram-Negative Bacteria in a Teaching Tertiary Care Hospital in North India
Original Article Vol. 25 No. 3 Ampc β-lactamase Production in Gram-Negative Bacilli:-Chaudhary U, et al. 129 Detection of Inducible AmpC β-lactamase-producing Gram-Negative Bacteria in a Teaching Tertiary
More informationGlobal Alliance for Infections in Surgery. Better understanding of the mechanisms of antibiotic resistance
Better understanding of the mechanisms of antibiotic resistance Antibiotic prescribing practices in surgery Contents Mechanisms of antibiotic resistance 4 Antibiotic resistance in Enterobacteriaceae 9
More informationA novel variant of the β-lactamase ADC-61 gene in multi-drug resistant Acinetobacter baumannii
A novel variant of the β-lactamase ADC-61 gene in multi-drug resistant Acinetobacter baumannii Y. Zhou, S.-J. Teng, L. Yang, S.-B. Li and Y. Xu Clinical Laboratory Department, The Second People s Hospital
More informationOvernight identification of imipenem-resistant Acinetobacter baumannii carriage in hospitalized patients
TABLE 1. Origin and carbapenem resistance characteristics of the 64 Acinetobacter baumannii stock D-750 Overnight identification of imipenem-resistant Acinetobacter baumannii carriage in hospitalized patients
More informationDefining Extended Spectrum b-lactamases: Implications of Minimum Inhibitory Concentration- Based Screening Versus Clavulanate Confirmation Testing
Infect Dis Ther (2015) 4:513 518 DOI 10.1007/s40121-015-0094-6 BRIEF REPORT Defining Extended Spectrum b-lactamases: Implications of Minimum Inhibitory Concentration- Based Screening Versus Clavulanate
More informationFlorida Health Care Association District 2 January 13, 2015 A.C. Burke, MA, CIC
Florida Health Care Association District 2 January 13, 2015 A.C. Burke, MA, CIC 11/20/2014 1 To describe carbapenem-resistant Enterobacteriaceae. To identify laboratory detection standards for carbapenem-resistant
More informationConsequences of Antimicrobial Resistant Bacteria. Antimicrobial Resistance. Molecular Genetics of Antimicrobial Resistance. Topics to be Covered
Antimicrobial Resistance Consequences of Antimicrobial Resistant Bacteria Change in the approach to the administration of empiric antimicrobial therapy Increased number of hospitalizations Increased length
More informationMID 23. Antimicrobial Resistance. Consequences of Antimicrobial Resistant Bacteria. Molecular Genetics of Antimicrobial Resistance
Antimicrobial Resistance Molecular Genetics of Antimicrobial Resistance Micro evolutionary change - point mutations Beta-lactamase mutation extends spectrum of the enzyme rpob gene (RNA polymerase) mutation
More informationAntimicrobial Resistance
Antimicrobial Resistance Consequences of Antimicrobial Resistant Bacteria Change in the approach to the administration of empiric antimicrobial therapy Increased number of hospitalizations Increased length
More informationAntimicrobial Resistance Acquisition of Foreign DNA
Antimicrobial Resistance Acquisition of Foreign DNA Levy, Scientific American Horizontal gene transfer is common, even between Gram positive and negative bacteria Plasmid - transfer of single or multiple
More informationOriginal Article. Ratri Hortiwakul, M.Sc.*, Pantip Chayakul, M.D.*, Natnicha Ingviya, B.Sc.**
Original Article In Vitro Activity of Cefminox and Other β-lactam Antibiotics Against Clinical Isolates of Extended- Spectrum-β-lactamase-Producing Klebsiella pneumoniae and Escherichia coli Ratri Hortiwakul,
More information5/4/2018. Multidrug Resistant Organisms (MDROs) Objectives. Outline. Define a multi-drug resistant organism (MDRO)
Multidrug Resistant Organisms (MDROs) Kasturi Shrestha, M.D. 05/11/2018 Objectives Define a multi-drug resistant organism (MDRO) Identify most challenging MDROs in healthcare Identify reasons for health
More informationDR. MICHAEL A. BORG DIRECTOR OF INFECTION PREVENTION & CONTROL MATER DEI HOSPITAL - MALTA
DR. MICHAEL A. BORG DIRECTOR OF INFECTION PREVENTION & CONTROL MATER DEI HOSPITAL - MALTA The good old days The dread (of) infections that used to rage through the whole communities is muted Their retreat
More informationBreaking the Ring. β-lactamases and the Great Arms Race. Bryce M Kayhart, PharmD, BCPS PGY2 Pharmacotherapy Resident Mayo Clinic - Rochester
Breaking the Ring β-lactamases and the Great Arms Race Bryce M Kayhart, PharmD, BCPS PGY2 Pharmacotherapy Resident Mayo Clinic - Rochester 2015 MFMER slide-1 Disclosures I have no relevant financial relationships
More informationNosocomial Infections: What Are the Unmet Needs
Nosocomial Infections: What Are the Unmet Needs Jean Chastre, MD Service de Réanimation Médicale Hôpital Pitié-Salpêtrière, AP-HP, Université Pierre et Marie Curie, Paris 6, France www.reamedpitie.com
More informationAntibiotic. Antibiotic Classes, Spectrum of Activity & Antibiotic Reporting
Antibiotic Antibiotic Classes, Spectrum of Activity & Antibiotic Reporting Any substance of natural, synthetic or semisynthetic origin which at low concentrations kills or inhibits the growth of bacteria
More informationTaiwan Surveillance of Antimicrobial Resistance (TSAR)
Taiwan Surveillance of Antimicrobial Resistance (TSAR) 2009 MIRL Symposium July 17, 2009 Tsai-Ling Yang Lauderdale ( ) Microbial Infections Reference Laboratory (MIRL) Division of Infectious Diseases,
More informationEpidemiology and Burden of Antimicrobial-Resistant P. aeruginosa Infections
Epidemiology and Burden of Antimicrobial-Resistant P. aeruginosa Infections Keith S. Kaye, MD, MPH Professor of Medicine Division of Infectious Diseases Department of Internal Medicine University of Michigan
More informationEXTENDED-SPECTRUM BETA-LACTAMASES EMERGING GRAM-NEGATIVE ORGANISMS
EXTENDED-SPECTRUM BETA-LACTAMASES EMERGING GRAM-NEGATIVE ORGANISMS David J. Feola, Pharm.D., Ph.D. Assistant Professor University of Kentucky College of Pharmacy Disclosures Research Funding Pfizer Objectives
More informationScreening and deciphering antibiotic resistance in Acinetobacter baumannii: a state of the art
For reprint orders, please contact reprints@expert-reviews.com Screening and deciphering antibiotic resistance in Acinetobacter baumannii: a state of the art Expert Rev. Anti Infect. Ther. 11(6), 571 583
More informationInternational Journal of Health Sciences and Research ISSN:
International Journal of Health Sciences and Research www.ijhsr.org ISSN: 2249-9571 Original Research Article Antibiotic Susceptibility Pattern of Pseudomonas Aeruginosa Isolated From Various Clinical
More informationREVIEW. Carbapenem resistance in Acinetobacter baumannii: mechanisms and epidemiology L. Poirel and P. Nordmann /j
REVIEW 10.1111/j.1469-0691.2006.01456.x Carbapenem resistance in Acinetobacter baumannii: mechanisms and epidemiology L. Poirel and P. Nordmann Service de Bactériologie-Virologie, Hôpital de Bicêtre, South-Paris
More informationAAC Accepts, published online ahead of print on 7 January 2008 Antimicrob. Agents Chemother. doi: /aac
AAC Accepts, published online ahead of print on January 00 Antimicrob. Agents Chemother. doi:./aac.0-0 Copyright 00, American Society for Microbiology and/or the Listed Authors/Institutions. All Rights
More informationEUCAST Subcommitee for Detection of Resistance Mechanisms (ESDReM)
EUCAST Subcommitee for Detection of Resistance Mechanisms (ESDReM) Christian G. Giske, MD/PhD Chairman of ESDReM Karolinska University Hospital and EUCAST ECCMID, 22 maj 2013 The background Guidance on
More informationMulti-drug resistant microorganisms
Multi-drug resistant microorganisms Arzu TOPELI Director of MICU Hacettepe University Faculty of Medicine, Ankara-Turkey Council Member of WFSICCM Deaths in the US declined by 220 per 100,000 with the
More informationComparison of Susceptibility of Gram Negative Bacilli to Cephalosporins and Ciprofloxacin
International Journal of Current Microbiology and Applied Sciences ISSN: 2319-7706 Volume 5 Number 9 (2016) pp. 205-212 Journal homepage: http://www.ijcmas.com Original Research Article http://dx.doi.org/10.20546/ijcmas.2016.509.023
More informationβ-lactams resistance among Enterobacteriaceae in Morocco 1 st ICREID Addis Ababa March 2018
β-lactams resistance among Enterobacteriaceae in Morocco 1 st ICREID Addis Ababa 12-14 March 2018 Antibiotic resistance center Institut Pasteur du Maroc Enterobacteriaceae (E. coli, Salmonella, ) S. aureus
More informationIntroduction to antimicrobial agents
Introduction to antimicrobial agents Kwan Soo Ko Action mechanisms of antimicrobials Bacteriostatic agents, such as tetracycline - Inhibit the growth and multiplication of bacteria - Upon exposure to a
More informationFighting MDR Pathogens in the ICU
Fighting MDR Pathogens in the ICU Dr. Murat Akova Hacettepe University School of Medicine, Department of Infectious Diseases, Ankara, Turkey 1 50.000 deaths each year in US and Europe due to antimicrobial
More informationAntimicrobial Resistance
Antimicrobial Resistance Consequences of Antimicrobial Resistant Bacteria Change in the approach to the administration of Change in the approach to the administration of empiric antimicrobial therapy Increased
More informationAntimicrobial Susceptibility Testing: Advanced Course
Antimicrobial Susceptibility Testing: Advanced Course Cascade Reporting Cascade Reporting I. Selecting Antimicrobial Agents for Testing and Reporting Selection of the most appropriate antimicrobials to
More informationWide dissemination of GES-type carbapenemases in Acinetobacter baumannii in. Kuwait
AAC Accepts, published online ahead of print on 22 October 2012 Antimicrob. Agents Chemother. doi:10.1128/aac.01384-12 Copyright 2012, American Society for Microbiology. All Rights Reserved. 1 2 Wide dissemination
More informationSuggestions for appropriate agents to include in routine antimicrobial susceptibility testing
Suggestions for appropriate agents to include in routine antimicrobial susceptibility testing These suggestions are intended to indicate minimum sets of agents to test routinely in a diagnostic laboratory
More informationThe impact of antimicrobial resistance on enteric infections in Vietnam Dr Stephen Baker
The impact of antimicrobial resistance on enteric infections in Vietnam Dr Stephen Baker sbaker@oucru.org Oxford University Clinical Research Unit, Ho Chi Minh City, Vietnam Outline The impact of antimicrobial
More informationEUCAST recommended strains for internal quality control
EUCAST recommended strains for internal quality control Escherichia coli Pseudomonas aeruginosa Staphylococcus aureus Enterococcus faecalis Streptococcus pneumoniae Haemophilus influenzae ATCC 59 ATCC
More informationß-lactams. Sub-families. Penicillins. Cephalosporins. Monobactams. Carbapenems
β-lactams ß-lactams Sub-families Penicillins Cephalosporins Monobactams Carbapenems ß-lactams Mode of action PBPs = Trans/Carboxy/Endo- peptidases PBP binding (Penicillin-Binding Proteins) activation of
More informationPrevalence of Extended Spectrum Beta- Lactamase Producers among Various Clinical Samples in a Tertiary Care Hospital: Kurnool District, India
International Journal of Current Microbiology and Applied Sciences ISSN: 319-77 Volume Number (17) pp. 57-3 Journal homepage: http://www.ijcmas.com Original Research Article https://doi.org/1.5/ijcmas.17..31
More informationAcinetobacter Resistance in Turkish Tertiary Care Hospitals. Zeliha KOCAK TUFAN, MD, Assoc. Prof.
Acinetobacter Resistance in Turkish Tertiary Care Hospitals Zeliha KOCAK TUFAN, MD, Assoc. Prof. Acinetobacter Problem Countries that have reported hospital outbreaks of carbapenem-resistant Acinetobacter
More informationEARS Net Report, Quarter
EARS Net Report, Quarter 4 213 March 214 Key Points for 213* Escherichia coli: The proportion of patients with invasive infections caused by E. coli producing extended spectrum β lactamases (ESBLs) increased
More information2016 Antibiotic Susceptibility Report
Fairview Northland Medical Center and Elk River, Milaca, Princeton and Zimmerman Clinics 2016 Antibiotic Susceptibility Report GRAM-NEGATIVE ORGANISMS 2016 Gram-Negative Non-Urine The number of isolates
More informationReceived: February 29, 2008 Revised: July 22, 2008 Accepted: August 4, 2008
J Microbiol Immunol Infect. 29;42:317-323 In vitro susceptibilities of aerobic and facultative anaerobic Gram-negative bacilli isolated from patients with intra-abdominal infections at a medical center
More informationChallenges Emerging resistance Fewer new drugs MRSA and other resistant pathogens are major problems
Micro 301 Antimicrobial Drugs 11/7/12 Significance of antimicrobial drugs Challenges Emerging resistance Fewer new drugs MRSA and other resistant pathogens are major problems Definitions Antibiotic Selective
More informationTHE NAC CHALLENGE PANEL OF ISOLATES FOR VERIFICATION OF ANTIBIOTIC SUSCEPTIBILITY TESTING METHODS
THE NAC CHALLENGE PANEL OF ISOLATES FOR VERIFICATION OF ANTIBIOTIC SUSCEPTIBILITY TESTING METHODS Stefanie Desmet University Hospitals Leuven Laboratory medicine microbiology stefanie.desmet@uzleuven.be
More informationBeta-lactamase Inhibitors May Induce Resistance to Beta-lactam Antibiotics in Bacteria Associated with Clinical Infections Bhoj Singh
Noto-are 14947537: Medicine. 2018-06-03. Beta-lactamase Inhibitors May Induce Resistance to Beta-lactam Antibiotics in Bacteria Associated with Clinical Infections Bhoj Singh Indian Veterinary Research
More informationORIGINAL ARTICLE /j x. Mallorca, Spain
ORIGINAL ARTICLE 10.1111/j.1469-0691.2005.01251.x Contribution of clonal dissemination and selection of mutants during therapy to Pseudomonas aeruginosa antimicrobial resistance in an intensive care unit
More informationPrevention, Management, and Reporting of Carbapenem-Resistant Enterobacteriaceae
Prevention, Management, and Reporting of Carbapenem-Resistant Enterobacteriaceae Dawn Terashita MD, MPH Acute Communicable Disease Control Los Angeles County Department of Public Health September 28, 2017
More informationNational Clinical Guideline Centre Pneumonia Diagnosis and management of community- and hospital-acquired pneumonia in adults
National Clinical Guideline Centre Antibiotic classifications Pneumonia Diagnosis and management of community- and hospital-acquired pneumonia in adults Clinical guideline 191 Appendix N 3 December 2014
More informationETX0282, a Novel Oral Agent Against Multidrug-Resistant Enterobacteriaceae
ETX0282, a Novel Oral Agent Against Multidrug-Resistant Enterobacteriaceae Thomas Durand-Réville 02 June 2017 - ASM Microbe 2017 (Session #113) Disclosures Thomas Durand-Réville: Full-time Employee; Self;
More informationThe β- Lactam Antibiotics. Munir Gharaibeh MD, PhD, MHPE School of Medicine, The University of Jordan November 2018
The β- Lactam Antibiotics Munir Gharaibeh MD, PhD, MHPE School of Medicine, The University of Jordan November 2018 Penicillins. Cephalosporins. Carbapenems. Monobactams. The β- Lactam Antibiotics 2 3 How
More informationMili Rani Saha and Sanya Tahmina Jhora. Department of Microbiology, Sir Salimullah Medical College, Mitford, Dhaka, Bangladesh
Detection of extended spectrum beta-lactamase producing Gram-negative organisms: hospital prevalence and comparison of double disc synergy and E-test methods Mili Rani Saha and Sanya Tahmina Jhora Original
More informationEuropean Committee on Antimicrobial Susceptibility Testing
European Committee on Antimicrobial Susceptibility Testing Routine and extended internal quality control for MIC determination and disk diffusion as recommended by EUCAST Version 8.0, valid from 018-01-01
More informationEuropean Committee on Antimicrobial Susceptibility Testing
European Committee on Antimicrobial Susceptibility Testing Routine and extended internal quality control as recommended by EUCAST Version 5.0, valid from 015-01-09 This document should be cited as "The
More informationDRUG-RESISTANT ACINETOBACTER BAUMANNII A GROWING SUPERBUG POPULATION. Cara Wilder Ph.D. Technical Writer March 13 th 2014
DRUG-RESISTANT ACINETOBACTER BAUMANNII A GROWING SUPERBUG POPULATION Cara Wilder Ph.D. Technical Writer March 13 th 2014 ATCC Founded in 1925, ATCC is a non-profit organization with headquarters in Manassas,
More informationGENERAL NOTES: 2016 site of infection type of organism location of the patient
GENERAL NOTES: This is a summary of the antibiotic sensitivity profile of clinical isolates recovered at AIIMS Bhopal Hospital during the year 2016. However, for organisms in which < 30 isolates were recovered
More informationMechanisms and Pathways of AMR in the environment
FMM/RAS/298: Strengthening capacities, policies and national action plans on prudent and responsible use of antimicrobials in fisheries Final Workshop in cooperation with AVA Singapore and INFOFISH 12-14
More informationOutline. Antimicrobial resistance. Antimicrobial resistance in gram negative bacilli. % susceptibility 7/11/2010
Multi-Drug Resistant Organisms Is Combination Therapy the Way to Go? Sutthiporn Pattharachayakul, PharmD Prince of Songkhla University, Thailand Outline Prevalence of anti-microbial resistance in Acinetobacter
More informationDoripenem: A new carbapenem antibiotic a review of comparative antimicrobial and bactericidal activities
REVIEW Doripenem: A new carbapenem antibiotic a review of comparative antimicrobial and bactericidal activities Fiona Walsh Department of Clinical Microbiology, Trinity College Dublin, Dublin, Ireland
More informationAntimicrobial Resistance Surveillance from sentinel public hospitals, South Africa, 2013
Antimicrobial Resistance Surveillance from sentinel public s, South Africa, 213 Authors: Olga Perovic 1,2, Melony Fortuin-de Smidt 1, and Verushka Chetty 1 1 National Institute for Communicable Diseases
More informationDetection of ESBL Producing Gram Negative Uropathogens and their Antibiotic Resistance Pattern from a Tertiary Care Centre, Bengaluru, India
ISSN: 2319-7706 Volume 4 Number 12 (2015) pp. 578-583 http://www.ijcmas.com Original Research Article Detection of ESBL Producing Gram Negative Uropathogens and their Antibiotic Resistance Pattern from
More informationAvailable online at ISSN No:
Available online at www.ijmrhs.com ISSN No: 2319-5886 International Journal of Medical Research & Health Sciences, 2017, 6(4): 36-42 Comparative Evaluation of In-Vitro Doripenem Susceptibility with Other
More information2015 Antibiotic Susceptibility Report
Citrobacter freundii Enterobacter aerogenes Enterobacter cloacae Escherichia coli Haemophilus influenzenza Klebsiella oxytoca Klebsiella pneumoniae Proteus mirabilis Pseudomonas aeruginosa Serratia marcescens
More informationMichael Hombach*, Guido V. Bloemberg and Erik C. Böttger
J Antimicrob Chemother 2012; 67: 622 632 doi:10.1093/jac/dkr524 Advance Access publication 13 December 2011 Effects of clinical breakpoint changes in CLSI guidelines 2010/2011 and EUCAST guidelines 2011
More informationa. 379 laboratories provided quantitative results, e.g (DD method) to 35.4% (MIC method) of all participants; see Table 2.
AND QUANTITATIVE PRECISION (SAMPLE UR-01, 2017) Background and Plan of Analysis Sample UR-01 (2017) was sent to API participants as a simulated urine culture for recognition of a significant pathogen colony
More informationAntimicrobial Resistance Strains
Antimicrobial Resistance Strains Microbiologics offers a wide range of strains with characterized antimicrobial resistance mechanisms including: Extended-Spectrum β-lactamases (ESBLs) Carbapenamases Vancomycin-Resistant
More informationPharmacology Week 6 ANTIMICROBIAL AGENTS
Pharmacology Week 6 ANTIMICROBIAL AGENTS Mechanisms of antimicrobial action Mechanisms of antimicrobial action Bacteriostatic - Slow or stop bacterial growth, needs an immune system to finish off the microbe
More information10/15/08. Activity of an Antibiotic. Affinity for target. Permeability properties (ability to get to the target)
Beta-lactam antibiotics Penicillins Target - Cell wall - interfere with cross linking Actively growing cells Bind to Penicillin Binding Proteins Enzymes involved in cell wall synthesis Activity of an Antibiotic
More informationAntimicrobial Susceptibility Testing: The Basics
Antimicrobial Susceptibility Testing: The Basics Susan E. Sharp, Ph.D., DABMM, FAAM Director, Airport Way Regional Laboratory Director, Regional Microbiology and Molecular Infectious Diseases Laboratories
More informationAntimicrobials. Antimicrobials
Antimicrobials For more than 50 years, antibiotics have come to the rescue by routinely producing rapid and long-lasting miracle cures. However, from the beginning antibiotics have selected for resistance
More informationALARMING RATES OF PREVALENCE OF ESBL PRODUCING E. COLI IN URINARY TRACT INFECTION CASES IN A TERTIARY CARE NEUROSPECIALITY HOSPITAL
ALARMING RATES OF PREVALENCE OF ESBL PRODUCING E. COLI IN URINARY TRACT INFECTION CASES IN A TERTIARY CARE NEUROSPECIALITY HOSPITAL Pearl. A Prabal*,Sourav Maiti Institute of Neurosciences, Kolkata, India
More informationCo-transfer of bla NDM-5 and mcr-1 by an IncX3 X4 hybrid plasmid in Escherichia coli 4
SUPPLEMENTARY INFORMATION ARTICLE NUMBER: 16176 DOI: 10.1038/NMICROBIOL.2016.176 Co-transfer of bla NDM-5 and mcr-1 by an IncX3 X4 hybrid plasmid in Escherichia coli 4 5 6 7 8 9 10 11 12 13 14 15 16 17
More informationRoutine internal quality control as recommended by EUCAST Version 3.1, valid from
Routine internal quality control as recommended by EUCAST Version.1, valid from 01-01-01 Escherichia coli Pseudomonas aeruginosa Staphylococcus aureus Enterococcus faecalis Streptococcus pneumoniae Haemophilus
More informationAntibiotic Updates: Part II
Antibiotic Updates: Part II Fredrick M. Abrahamian, DO, FACEP, FIDSA Health Sciences Clinical Professor of Emergency Medicine David Geffen School of Medicine at UCLA Los Angeles, California Financial Disclosures
More informationETX2514SUL (sulbactam/etx2514) for the treatment of Acinetobacter baumannii infections
ETX2514SUL (sulbactam/etx2514) for the treatment of Acinetobacter baumannii infections Robin Isaacs Chief Medical Officer, Entasis Therapeutics Dr. Isaacs is a full-time employee of Entasis Therapeutics.
More informationSepsis is the most common cause of death in
ADDRESSING ANTIMICROBIAL RESISTANCE IN THE INTENSIVE CARE UNIT * John P. Quinn, MD ABSTRACT Two of the more common strategies for optimizing antimicrobial therapy in the intensive care unit (ICU) are antibiotic
More informationOther Beta - lactam Antibiotics
Other Beta - lactam Antibiotics Assistant Professor Dr. Naza M. Ali Lec 5 8 Nov 2017 Lecture outlines Other beta lactam antibiotics Other inhibitors of cell wall synthesis Other beta-lactam Antibiotics
More informationAvailable Online at International Journal of Pharmaceutical & Biological Archives 2011; 2(5): ORIGINAL RESEARCH ARTICLE
ISSN 0976 3333 Available Online at www.ijpba.info International Journal of Pharmaceutical & Biological Archives 2011; 2(5):1502-1508 ORIGINAL RESEARCH ARTICLE Screening of ESBL (Extended Spectrum of β
More information10/9/2012. Unprecedented success of antibiotics in 1960s. Infectious diseases are #1 cause of mortality worldwide
I have no conflicts of interest in relation to this program Whitney Jones, PharmD Antimicrobial Stewardship Pharmacist Vanderbilt University Medical Center October 25, 2012 Understand the epidemiology
More informationAPPENDIX III - DOUBLE DISK TEST FOR ESBL
Policy # MI\ANTI\04\03\v03 Page 1 of 5 Section: Antimicrobial Susceptibility Testing Manual Subject Title: Appendix III - Double Disk Test for ESBL Issued by: LABORATORY MANAGER Original Date: January
More informationReceived 14 August 2004/Returned for modification 8 November 2004/Accepted 1 May 2005
ANTIMICROBIAL AGENTS AND CHEMOTHERAPY, Aug. 2005, p. 3533 3537 Vol. 49, No. 8 0066-4804/05/$08.00 0 doi:10.1128/aac.49.8.3533 3537.2005 Copyright 2005, American Society for Microbiology. All Rights Reserved.
More information